Discovery and characterization of cysteine-rich peptides from Acanthopanax trifoliatus

Cysteine-rich peptides (CRPs) are a family of mini-proteins found in various organisms that have a molecular mass of 2 to 5 kDa and are reported to contain 6 to 10 cysteine residues. The cysteine residues inter-cross to form disulfide bonds which grant CRPs a robust 3dimensional configuration, provi...

Full description

Saved in:
Bibliographic Details
Main Author: Goh, Jia Xuan
Other Authors: Jimmy Pingkwan Tam @ James P Tam
Format: Final Year Project
Language:English
Published: 2017
Subjects:
Online Access:http://hdl.handle.net/10356/72497
Tags: Add Tag
No Tags, Be the first to tag this record!
id sg-ntu-dr.10356-72497
record_format dspace
spelling sg-ntu-dr.10356-724972023-02-28T18:02:37Z Discovery and characterization of cysteine-rich peptides from Acanthopanax trifoliatus Goh, Jia Xuan Jimmy Pingkwan Tam @ James P Tam School of Biological Sciences DRNTU::Science Cysteine-rich peptides (CRPs) are a family of mini-proteins found in various organisms that have a molecular mass of 2 to 5 kDa and are reported to contain 6 to 10 cysteine residues. The cysteine residues inter-cross to form disulfide bonds which grant CRPs a robust 3dimensional configuration, providing resistance against thermal, enzymatic and pH degradation. As such, they are speculated to be the reason behind the biological activity of orally-taken herbal decoctions. In this study, a CRP of weight 3670 Da was successfully isolated from crude Acanthopanax trifoliatus extract, which leaves are widely used in traditional Chinese medicine. It was termed as aT3670 and from de novo sequencing, was discovered to have a sequence of QVCSTAGQSCGGEQVCCDGCICNSKFIRPYCFGEC. Query via NCBI tBLASTn search uncovered that aT3670 shares similar homology to numerous peptides. All the peptides were observed to contain a similar cysteine motif of CC-CC-C-C-C. Hence, the disulfide connectivity of aT3670 was speculated to be as follows, Cys I–IV, Cys II–V, Cys III–VI, forming a cystine knot with an additional disulfide bond of Cys VI–VIII. This project provides further insight into the characterization and sequencing of aT3670 for future possible investigations as a potential orally active drug. Bachelor of Science in Biomedical Sciences 2017-08-16T07:46:07Z 2017-08-16T07:46:07Z 2017 Final Year Project (FYP) http://hdl.handle.net/10356/72497 en Nanyang Technological University 35 p. application/pdf
institution Nanyang Technological University
building NTU Library
continent Asia
country Singapore
Singapore
content_provider NTU Library
collection DR-NTU
language English
topic DRNTU::Science
spellingShingle DRNTU::Science
Goh, Jia Xuan
Discovery and characterization of cysteine-rich peptides from Acanthopanax trifoliatus
description Cysteine-rich peptides (CRPs) are a family of mini-proteins found in various organisms that have a molecular mass of 2 to 5 kDa and are reported to contain 6 to 10 cysteine residues. The cysteine residues inter-cross to form disulfide bonds which grant CRPs a robust 3dimensional configuration, providing resistance against thermal, enzymatic and pH degradation. As such, they are speculated to be the reason behind the biological activity of orally-taken herbal decoctions. In this study, a CRP of weight 3670 Da was successfully isolated from crude Acanthopanax trifoliatus extract, which leaves are widely used in traditional Chinese medicine. It was termed as aT3670 and from de novo sequencing, was discovered to have a sequence of QVCSTAGQSCGGEQVCCDGCICNSKFIRPYCFGEC. Query via NCBI tBLASTn search uncovered that aT3670 shares similar homology to numerous peptides. All the peptides were observed to contain a similar cysteine motif of CC-CC-C-C-C. Hence, the disulfide connectivity of aT3670 was speculated to be as follows, Cys I–IV, Cys II–V, Cys III–VI, forming a cystine knot with an additional disulfide bond of Cys VI–VIII. This project provides further insight into the characterization and sequencing of aT3670 for future possible investigations as a potential orally active drug.
author2 Jimmy Pingkwan Tam @ James P Tam
author_facet Jimmy Pingkwan Tam @ James P Tam
Goh, Jia Xuan
format Final Year Project
author Goh, Jia Xuan
author_sort Goh, Jia Xuan
title Discovery and characterization of cysteine-rich peptides from Acanthopanax trifoliatus
title_short Discovery and characterization of cysteine-rich peptides from Acanthopanax trifoliatus
title_full Discovery and characterization of cysteine-rich peptides from Acanthopanax trifoliatus
title_fullStr Discovery and characterization of cysteine-rich peptides from Acanthopanax trifoliatus
title_full_unstemmed Discovery and characterization of cysteine-rich peptides from Acanthopanax trifoliatus
title_sort discovery and characterization of cysteine-rich peptides from acanthopanax trifoliatus
publishDate 2017
url http://hdl.handle.net/10356/72497
_version_ 1759854697637740544